Recombinant Full Length Human GGTLC1 Protein, GST-tagged

Cat.No. : GGTLC1-5245HF
Product Overview : Human GGTLA4 full-length ORF ( NP_563577.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 225 amino acids
Description : This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Molecular Mass : 50.7 kDa
AA Sequence : MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GGTLC1 gamma-glutamyltransferase light chain 1 [ Homo sapiens ]
Official Symbol GGTLC1
Synonyms gamma-glutamyltransferase light chain 1; 16437; Ensembl:ENSG00000149435; MGC50550; gamma-glutamyltransferase light chain 1;gamma-glutamyl transpeptidase;gamma-glutamyltransferase-like protein 6;gamma-glutamyltransferase-like activity 3;gamma-glutamyltransferase-like activity 4; 2.3.2.2; GGTL6; GGTLA3; GGTLA4; dJ831C21.1; dJ831C21.2
Gene ID 92086
mRNA Refseq NM_178311
Protein Refseq NP_842563
MIM 612338
UniProt ID Q9BX51

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GGTLC1 Products

Required fields are marked with *

My Review for All GGTLC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon