Recombinant Human GGCX Protein, GST-tagged

• Cat.No.: GGCX-4870H
• Product Overview: Human GGCX partial ORF ( NP_000812, 533 a.a. - 629 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency. Multiple transcript variants encoding different isoforms have been found for this gene
• Molecular Mass: 36.41 kDa
• AA Sequence: ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GGCX gamma-glutamyl carboxylase [ Homo sapiens ]
• Official Symbol: GGCX
• Synonyms: GGCX; gamma-glutamyl carboxylase; vitamin K-dependent gamma-carboxylase; vitamin K dependent gamma carboxylase; VKCFD1; peptidyl-glutamate 4-carboxylase; FLJ26629
• Gene ID: 2677
• mRNA Refseq: NM_000821
• Protein Refseq: NP_000812
• MIM: 137167
• UniProt ID: P38435