Recombinant Human GGCX

• Cat.No.: GGCX-29018TH
• Product Overview: Recombinant fragment corresponding to amino acids 533-629 of Human GGCX with an N terminal proprietary tag; Predicted MWt 36.3 kDa.

Specification

• Description: This gene encodes an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.
• Protein length: 97 amino acids
• Molecular Weight: 36.300kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS
• Sequence Similarities: Belongs to the vitamin K-dependent gamma-carboxylase family.

Gene Information

• Gene Name: GGCX gamma-glutamyl carboxylase [ Homo sapiens ]
• Official Symbol: GGCX
• Synonyms: GGCX; gamma-glutamyl carboxylase; vitamin K-dependent gamma-carboxylase; vitamin K dependent gamma carboxylase; VKCFD1
• Gene ID: 2677
• mRNA Refseq: NM_000821
• Protein Refseq: NP_000812
• MIM: 137167
• Uniprot ID: P38435
• Chromosome Location: 2p12
• Pathway: Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem
• Function: gamma-glutamyl carboxylase activity; lyase activity