Recombinant Human GFAP protein, His-tagged

• Cat.No.: GFAP-19H
• Product Overview: Recombinant Human GFAP (Leu292-Met432) fussed with His tag at N-terminal was expressed in E. coli.

Specification

• Description: Glial Fibrillary Acidic Protein (GFAP) is an intermediate filament (IF) protein which belongs to the intermediate filament family. GFAP is expressed in numerous cell types of the central nervous system (CNS), ependymal cells and phosphorylated by PKN1. GFAP, a class-III intermediate filament, is a cell-specific marker during the development of the central nervous system and distinguishes astrocytes from other glial cells. It is closely related to its non-epithelial family members, vimentin, desmin, and peripherin, which are all involved in the structure and function of the cell’s cytoskeleton. GFAP is thought to help to maintain astrocyte mechanical strength, as well as the shape of cells but its exact function remains poorly understood.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.25
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEG QSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Protein length: 292-432 a.a.

Gene Information

• Gene Name: GFAP glial fibrillary acidic protein [ Homo sapiens ]
• Official Symbol: GFAP
• Synonyms: ALXDRD; glial fibrillary acidic protein
• Gene ID: 2670
• mRNA Refseq: NM_002055
• Protein Refseq: NP_002046
• MIM: 137780
• UniProt ID: P14136
• Chromosome Location: 17q21
• Pathway: Neural Crest Differentiation, organism-specific biosystem; Nuclear signaling by ERBB4, organism-specific biosystem; Signal Transduction, organism-specific biosystem
• Function: integrin binding; kinase binding; protein binding