Recombinant Full Length Human GFAP Protein
Cat.No. : | GFAP-188HF |
Product Overview : | Recombinant full length Human GFAP (amino acids 1-432) with a N terminal proprietary tag; predicted MWt 73.59kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 432 amino acids |
Description : | This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | Liquid |
Molecular Mass : | 73.590kDa inclusive of tags |
AA Sequence : | MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLA RMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRF ASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETN LRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFL RKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVRE AASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVS EGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GFAP glial fibrillary acidic protein [ Homo sapiens ] |
Official Symbol | GFAP |
Synonyms | GFAP; glial fibrillary acidic protein; FLJ45472; intermediate filament protein |
Gene ID | 2670 |
mRNA Refseq | NM_001131019 |
Protein Refseq | NP_001124491 |
MIM | 137780 |
UniProt ID | P14136 |
◆ Recombinant Proteins | ||
ANKZF1-3525H | Recombinant Human ANKZF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
L1-24H | Recombinant HPV16 L1 Protein | +Inquiry |
FERT2-5819M | Recombinant Mouse FERT2 Protein | +Inquiry |
S100A2-429H | Recombinant Human S100 Calcium Binding Protein A2 | +Inquiry |
CTF1-184H | Active Recombinant Human Cardiotrophin 1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPSF7-7301HCL | Recombinant Human CPSF7 293 Cell Lysate | +Inquiry |
BATF-155HCL | Recombinant Human BATF cell lysate | +Inquiry |
Diaphragm-103R | Rhesus monkey Diaphragm Lysate | +Inquiry |
F8-6482HCL | Recombinant Human F8 293 Cell Lysate | +Inquiry |
PECI-3310HCL | Recombinant Human PECI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFAP Products
Required fields are marked with *
My Review for All GFAP Products
Required fields are marked with *
0
Inquiry Basket