Recombinant Human GDI2 protein, His-SUMO-tagged
Cat.No. : | GDI2-2954H |
Product Overview : | Recombinant Human GDI2 protein(P50395)(1-445aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-445aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.7 kDa |
AA Sequence : | MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GDI2 GDP dissociation inhibitor 2 [ Homo sapiens ] |
Official Symbol | GDI2 |
Synonyms | GDI2; GDP dissociation inhibitor 2; rab GDP dissociation inhibitor beta; rab GDP dissociation; RABGDIB; GDI-2; rab GDI beta; rab GDP-dissociation inhibitor, beta; guanosine diphosphate dissociation inhibitor 2; FLJ16452; FLJ37352; |
Gene ID | 2665 |
mRNA Refseq | NM_001115156 |
Protein Refseq | NP_001108628 |
MIM | 600767 |
UniProt ID | P50395 |
◆ Recombinant Proteins | ||
GDI2-2505R | Recombinant Rat GDI2 Protein | +Inquiry |
GDI2-5151H | Recombinant Human GDI2 protein, GST-tagged | +Inquiry |
GDI2-2603H | Recombinant Human GDI2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GDI2-10054Z | Recombinant Zebrafish GDI2 | +Inquiry |
GDI2-161H | Recombinant Human GDI2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDI2-5964HCL | Recombinant Human GDI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDI2 Products
Required fields are marked with *
My Review for All GDI2 Products
Required fields are marked with *
0
Inquiry Basket