Recombinant Human GDI2

Description :	GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein length :	100 amino acids
Molecular Weight :	36.630kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Ubiquitous.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	QGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Sequence Similarities :	Belongs to the Rab GDI family.
Tag :	Non

Gene Name	GDI2 GDP dissociation inhibitor 2 [ Homo sapiens ]
Official Symbol	GDI2
Synonyms	GDI2; GDP dissociation inhibitor 2; rab GDP dissociation inhibitor beta; rab GDP dissociation; RABGDIB;
Gene ID	2665
mRNA Refseq	NM_001115156
Protein Refseq	NP_001108628
MIM	600767
Uniprot ID	P50395
Chromosome Location	10p15
Pathway	Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function	GTPase activator activity; Rab GDP-dissociation inhibitor activity; Rab GTPase activator activity; protein binding;