Recombinant Human GDF2 protein, His-tagged
Cat.No. : | GDF2-4269H |
Product Overview : | Recombinant Human GDF2 protein(Q9UK05)(300-429aa), fused to N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 300-429aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.3 kDa |
AA Sequence : | HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GDF2 growth differentiation factor 2 [ Homo sapiens ] |
Official Symbol | GDF2 |
Synonyms | GDF2; growth differentiation factor 2; growth/differentiation factor 2; BMP 9; BMP9; GDF-2; bone morphogenetic protein 9; BMP-9; |
Gene ID | 2658 |
mRNA Refseq | NM_016204 |
Protein Refseq | NP_057288 |
MIM | 605120 |
UniProt ID | Q9UK05 |
◆ Recombinant Proteins | ||
GDF2-5235HF | Recombinant Full Length Human GDF2 Protein, GST-tagged | +Inquiry |
GDF2-6982C | Recombinant Chicken GDF2 | +Inquiry |
GDF2-119H | Active Recombinant Human GDF2 Protein (Ser320-Arg429), N-His tagged, Animal-free, Carrier-free | +Inquiry |
GDF2-4269H | Recombinant Human GDF2 protein, His-tagged | +Inquiry |
GDF2-019H | Active Recombinant Human GDF2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF2-5970HCL | Recombinant Human GDF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF2 Products
Required fields are marked with *
My Review for All GDF2 Products
Required fields are marked with *
0
Inquiry Basket