Recombinant Human GDF2 protein, His-tagged

• Cat.No.: GDF2-4269H
• Product Overview: Recombinant Human GDF2 protein(Q9UK05)(300-429aa), fused to N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 300-429aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.3 kDa
• AA Sequence: HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GDF2 growth differentiation factor 2 [ Homo sapiens ]
• Official Symbol: GDF2
• Synonyms: GDF2; growth differentiation factor 2; growth/differentiation factor 2; BMP 9; BMP9; GDF-2; bone morphogenetic protein 9; BMP-9
• Gene ID: 2658
• mRNA Refseq: NM_016204
• Protein Refseq: NP_057288
• MIM: 605120
• UniProt ID: Q9UK05