Recombinant Human GDF15 protein, His-tagged
Cat.No. : | GDF15-285H |
Product Overview : | Recombinant Human GDF15 protein is produced by E. coli expression system. This protein is fused with a His tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala195-Ile308 |
Form : | PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. |
Molecular Mass : | 16 kDa |
AA Sequence : | ARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Purity : | > 95 % |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | GDF15 growth differentiation factor 15 [ Homo sapiens ] |
Official Symbol | GDF15 |
Synonyms | GDF15; MIC 1; MIC1; NAG 1; PDF; PLAB; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; MIC-1; NAG-1; GDF-15; |
Gene ID | 9518 |
mRNA Refseq | NM_004864 |
Protein Refseq | NP_004855 |
MIM | 605312 |
UniProt ID | Q99988 |
◆ Recombinant Proteins | ||
GDF15-28170TH | Recombinant Human GDF15, His-tagged | +Inquiry |
GDF15-4755H | Recombinant Human GDF15 protein(Ala197-Ile308) | +Inquiry |
GDF15-5644C | Recombinant Cynomolgus GDF15 protein, hFc-tagged, Biotinylated, Primary Amine Labeling | +Inquiry |
GDF15-6285M | Recombinant Mouse Gdf15 protein, His-tagged | +Inquiry |
GDF15-6743H | Recombinant Human GDF15 protein, hFc-tagged, Biotinylated, Primary Amine Labeling | +Inquiry |
◆ Native Proteins | ||
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF15-2705HCL | Recombinant Human GDF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF15 Products
Required fields are marked with *
My Review for All GDF15 Products
Required fields are marked with *
0
Inquiry Basket