Active Recombinant Human/Mouse/Rat GDF11 Protein

Description :	Growth differentiation factor 11 (GDF-11), also known as bone morphogenetic protein 11 (BMP-11), is a regulator of cell growth and differentiation during muscular and neural development. GDF-11 binds the transforming growth factor-beta receptors ALK4, ALK5, and ALK7 to activate SMAD signaling. In adults, exogenous GDF-11 promotes cardiomyocyte regeneration to reverse age-related cardiac hypertrophy.
Source :	E. coli
Species :	Human/Mouse/Rat
Bio-activity :	Alkaline phosphatase activity in ATDC5 cells, ≤100 ng/mL
Molecular Mass :	Dimer, 12.5/24.9 kDa (109/218 aa)
AA Sequence :	NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Endotoxin :	≤1 EUs/μg, Kinetic LAL
Purity :	≥95%, Reducing and Non-Reducing SDS PAGE
Stability :	12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage :	Storage Prior to Reconstitution: -20 centigrade
Storage Buffer :	Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution :	Sterile 10 mM HCl at 0.1 mg/mL
Shipping :	Room temperature
Instructions :	Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Name	GDF11 growth differentiation factor 11 [ Homo sapiens (human) ]
Official Symbol	GDF11
Synonyms	GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11;
Gene ID	10220
mRNA Refseq	NM_005811
Protein Refseq	NP_005802
MIM	603936
UniProt ID	O95390

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry