Recombinant Human GDAP1 Protein, GST-tagged

• Cat.No.: GDAP1-4811H
• Product Overview: Human GDAP1 full-length ORF ( AAH24939, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.64 kDa
• AA Sequence: MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GDAP1 ganglioside induced differentiation associated protein 1 [ Homo sapiens ]
• Official Symbol: GDAP1
• Synonyms: GDAP1; ganglioside induced differentiation associated protein 1; Charcot Marie Tooth neuropathy 4A, CMT4A; ganglioside-induced differentiation-associated protein 1; CMT4; Charcot-Marie-Tooth neuropathy 4A; ganglioside differentiation associated protein 1; CMT4A; CMTRIA
• Gene ID: 54332
• mRNA Refseq: NM_001040875
• Protein Refseq: NP_001035808
• MIM: 606598
• UniProt ID: Q8TB36