Recombinant Human GDAP1 Protein, GST-tagged

Cat.No. : GDAP1-4811H
Product Overview : Human GDAP1 full-length ORF ( AAH24939, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 57.64 kDa
AA Sequence : MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GDAP1 ganglioside induced differentiation associated protein 1 [ Homo sapiens ]
Official Symbol GDAP1
Synonyms GDAP1; ganglioside induced differentiation associated protein 1; Charcot Marie Tooth neuropathy 4A, CMT4A; ganglioside-induced differentiation-associated protein 1; CMT4; Charcot-Marie-Tooth neuropathy 4A; ganglioside differentiation associated protein 1; CMT4A; CMTRIA;
Gene ID 54332
mRNA Refseq NM_001040875
Protein Refseq NP_001035808
MIM 606598
UniProt ID Q8TB36

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GDAP1 Products

Required fields are marked with *

My Review for All GDAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon