Recombinant Human GCSH, His-tagged
Cat.No. : | GCSH-27469TH |
Product Overview : | Recombinant full length Human GCSH with N terminal His tag; 149 amino acids with tag, Predicted MWt 16.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125 amino acids |
Description : | Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome. |
Conjugation : | HIS |
Molecular Weight : | 16.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE |
Sequence Similarities : | Belongs to the gcvH family.Contains 1 lipoyl-binding domain. |
Gene Name | GCSH glycine cleavage system protein H (aminomethyl carrier) [ Homo sapiens ] |
Official Symbol | GCSH |
Synonyms | GCSH; glycine cleavage system protein H (aminomethyl carrier); glycine cleavage system H protein, mitochondrial; lipoic acid containing protein; |
Gene ID | 2653 |
mRNA Refseq | NM_004483 |
Protein Refseq | NP_004474 |
MIM | 238330 |
Uniprot ID | P23434 |
Chromosome Location | 16q23.2 |
Function | aminomethyltransferase activity; enzyme binding; |
◆ Recombinant Proteins | ||
Gcsh-3178M | Recombinant Mouse Gcsh Protein, Myc/DDK-tagged | +Inquiry |
GCSH-6276M | Recombinant Mouse GCSH Protein | +Inquiry |
GCSH-27469TH | Recombinant Human GCSH, His-tagged | +Inquiry |
GCSH-4809H | Recombinant Human GCSH Protein, GST-tagged | +Inquiry |
GCSH-450H | Recombinant Human GCSH protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCSH-5975HCL | Recombinant Human GCSH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCSH Products
Required fields are marked with *
My Review for All GCSH Products
Required fields are marked with *
0
Inquiry Basket