Recombinant Human GCSH, His-tagged

• Cat.No.: GCSH-27469TH
• Product Overview: Recombinant full length Human GCSH with N terminal His tag; 149 amino acids with tag, Predicted MWt 16.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 125 amino acids
• Description: Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.
• Conjugation: HIS
• Molecular Weight: 16.400kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
• Sequence Similarities: Belongs to the gcvH family.Contains 1 lipoyl-binding domain.

Gene Information

• Gene Name: GCSH glycine cleavage system protein H (aminomethyl carrier) [ Homo sapiens ]
• Official Symbol: GCSH
• Synonyms: GCSH; glycine cleavage system protein H (aminomethyl carrier); glycine cleavage system H protein, mitochondrial; lipoic acid containing protein
• Gene ID: 2653
• mRNA Refseq: NM_004483
• Protein Refseq: NP_004474
• MIM: 238330
• Uniprot ID: P23434
• Chromosome Location: 16q23.2
• Function: aminomethyltransferase activity; enzyme binding