Recombinant Human GCSH Protein, GST-tagged

• Cat.No.: GCSH-4809H
• Product Overview: Human GCSH full-length ORF ( AAH00790.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.[supplied by OMIM
• Molecular Mass: 44.77 kDa
• AA Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GCSH glycine cleavage system protein H (aminomethyl carrier) [ Homo sapiens ]
• Official Symbol: GCSH
• Synonyms: GCSH; glycine cleavage system protein H (aminomethyl carrier); glycine cleavage system H protein, mitochondrial; lipoic acid containing protein; lipoic acid-containing protein; mitochondrial glycine cleavage system H-protein; GCE; NKH
• Gene ID: 2653
• mRNA Refseq: NM_004483
• Protein Refseq: NP_004474
• MIM: 238330
• UniProt ID: P23434