Recombinant Human GCNT2, His-tagged

Cat.No. : GCNT2-89H
Product Overview : Recombinant Human N-Acetyllactosaminide β-1,6-N-Acetylglucosaminyl-Transferase Isoform C/GCNT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg21-Phe402) of Human GCNT2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-402 a.a.
AA Sequence : RFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYIT SPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNA FIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNI TPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRD QRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHG ICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYFLDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens ]
Official Symbol GCNT2
Synonyms GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital , CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme , glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group) , glucosaminyl (N acetyl) transferase 5 , II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396;
Gene ID 2651
mRNA Refseq NM_001491
Protein Refseq NP_001482
MIM 600429
UniProt ID Q06430
Chromosome Location 6p24.2
Pathway Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GCNT2 Products

Required fields are marked with *

My Review for All GCNT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon