Recombinant Human GCNT2, His-tagged

• Cat.No.: GCNT2-89H
• Product Overview: Recombinant Human N-Acetyllactosaminide β-1,6-N-Acetylglucosaminyl-Transferase Isoform C/GCNT2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg21-Phe402) of Human GCNT2 fused with a polyhistidine tag at the C-terminus.

Specification

• AA Sequence: RFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYIT SPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNA FIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNI TPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRD QRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHG ICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYFLDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 21-402 a.a.

Gene Information

• Gene Name: GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens ]
• Official Symbol: GCNT2
• Synonyms: GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital , CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme , glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group) , glucosaminyl (N acetyl) transferase 5 , II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396
• Gene ID: 2651
• mRNA Refseq: NM_001491
• Protein Refseq: NP_001482
• MIM: 600429
• UniProt ID: Q06430
• Chromosome Location: 6p24.2
• Pathway: Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups