Recombinant Human GC Protein, His-tagged
Cat.No. : | GC-1222H |
Product Overview : | Recombinant Human GC Protein (19-474aa) Protein was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-474 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 55.0 kDa |
AA Sequence : | RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | GC group-specific component (vitamin D binding protein) [ Homo sapiens ] |
Official Symbol | GC |
Synonyms | GC; group-specific component (vitamin D binding protein); vitamin D-binding protein; DBP; hDBP; VDBP; VDB; gc-globulin; vitamin D-binding alpha-globulin; GRD3; VDBG; DBP/GC |
Gene ID | 2638 |
mRNA Refseq | NM_000583 |
Protein Refseq | NP_000574 |
UniProt ID | P02774 |
◆ Recombinant Proteins | ||
GC-5160HF | Recombinant Full Length Human GC Protein, GST-tagged | +Inquiry |
GC-707R | Recombinant RVFV GC Protein (Cys691-Ser1139) (Strain MP12), His-tagged | +Inquiry |
GC-3500M | Recombinant Mouse GC Protein, His (Fc)-Avi-tagged | +Inquiry |
GC-1825H | Recombinant Human GC protein, His & T7-tagged | +Inquiry |
Gc-1827M | Recombinant Mouse Gc protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GC-198H | Native Human GC-Globulin | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GC-5995HCL | Recombinant Human GC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GC Products
Required fields are marked with *
My Review for All GC Products
Required fields are marked with *
0
Inquiry Basket