Recombinant Human GC Protein, His-tagged

• Cat.No.: GC-200H
• Product Overview: Recombinant Human GC, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene
• Source: HEK293 cells
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Molecular Mass: 52.3kD
• AA Sequence: LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: GC group-specific component (vitamin D binding protein) [ Homo sapiens ]
• Official Symbol: GC
• Synonyms: GC; group-specific component (vitamin D binding protein); vitamin D-binding protein; DBP; hDBP; VDBP; VDB; gc-globulin; vitamin D-binding alpha-globulin; GRD3; VDBG; DBP/GC
• Gene ID: 2638
• mRNA Refseq: NM_000583
• Protein Refseq: NP_000574
• UniProt ID: P02774