Recombinant Human GBE1
Cat.No. : | GBE1-28989TH |
Product Overview : | Recombinant fragment of Human GBE1 (aa 605-702) with a N terminal proprietary tag: predicted molecular weight 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersens disease). |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Highest levels found in liver and muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN |
Sequence Similarities : | Belongs to the glycosyl hydrolase 13 family. |
Gene Name | GBE1 glucan (1,4-alpha-), branching enzyme 1 [ Homo sapiens ] |
Official Symbol | GBE1 |
Synonyms | GBE1; glucan (1,4-alpha-), branching enzyme 1; 1,4-alpha-glucan-branching enzyme; Andersen disease; glycogen branching enzyme; glycogen storage disease type IV; |
Gene ID | 2632 |
mRNA Refseq | NM_000158 |
Protein Refseq | NP_000149 |
MIM | 607839 |
Uniprot ID | Q04446 |
Chromosome Location | 3 |
Pathway | Glucose metabolism, organism-specific biosystem; Glycogen Metabolism, organism-specific biosystem; Glycogen synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; |
Function | 1,4-alpha-glucan branching enzyme activity; cation binding; hydrolase activity, hydrolyzing O-glycosyl compounds; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
GBE1-187HF | Recombinant Full Length Human GBE1 Protein | +Inquiry |
GBE1-4771H | Recombinant Human GBE1 Protein, GST-tagged | +Inquiry |
GBE1-1322H | Recombinant Human GBE1 Protein, MYC/DDK-tagged | +Inquiry |
GBE1-2146HFL | Recombinant Full Length Human GBE1 Protein, C-Flag-tagged | +Inquiry |
GBE1-28989TH | Recombinant Human GBE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBE1-5999HCL | Recombinant Human GBE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBE1 Products
Required fields are marked with *
My Review for All GBE1 Products
Required fields are marked with *
0
Inquiry Basket