Recombinant Full Length Human GBE1 Protein, C-Flag-tagged
Cat.No. : | GBE1-2146HFL |
Product Overview : | Recombinant Full Length Human GBE1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 80.3 kDa |
AA Sequence : | MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFS RGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGS KLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHE GKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMG IIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYR FDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSL AFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESY HYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPS KSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL PN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Starch and sucrose metabolism |
Full Length : | Full L. |
Gene Name | GBE1 1,4-alpha-glucan branching enzyme 1 [ Homo sapiens (human) ] |
Official Symbol | GBE1 |
Synonyms | GBE; APBD; GSD4 |
Gene ID | 2632 |
mRNA Refseq | NM_000158.4 |
Protein Refseq | NP_000149.4 |
MIM | 607839 |
UniProt ID | Q04446 |
◆ Recombinant Proteins | ||
GBE1-1639R | Recombinant Rhesus Macaque GBE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GBE1-4771H | Recombinant Human GBE1 Protein, GST-tagged | +Inquiry |
GBE1-967H | Recombinant Human GBE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GBE1-28988TH | Recombinant Human GBE1 | +Inquiry |
GBE1-1818R | Recombinant Rhesus monkey GBE1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBE1-5999HCL | Recombinant Human GBE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBE1 Products
Required fields are marked with *
My Review for All GBE1 Products
Required fields are marked with *
0
Inquiry Basket