Recombinant Human GATA3 protein, GST-tagged

• Cat.No.: GATA3-2939H
• Product Overview: Recombinant Human GATA3(1-262aa) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Protein length: 1-262aa
• AA Sequence: MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRY PPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHL FTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPY VPEYSSGLFPPSSLLGGSPTGFGCKSRPKA
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Reconstitution: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: GATA3 GATA binding protein 3 [ Homo sapiens ]
• Official Symbol: GATA3
• Synonyms: GATA3; GATA binding protein 3; trans-acting T-cell-specific transcription factor GATA-3; HDR; GATA-binding factor 3; HDRS; MGC2346; MGC5199; MGC5445
• Gene ID: 2625
• mRNA Refseq: NM_001002295
• Protein Refseq: NP_001002295
• MIM: 131320
• UniProt ID: P23771
• Chromosome Location: 10p15
• Pathway: Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem
• Function: DNA binding; E-box binding; HMG box domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; core promoter proximal region sequence-specific DNA binding; core promoter sequence-specific DNA binding; metal ion binding; nucleic acid binding transcription factor activity; nucleic acid binding transcription factor activity; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding; zinc ion binding