Recombinant Human GALC protein
Cat.No. : | GALC-6743H |
Product Overview : | Recombinant Human GALC protein(P54803)(43-685aa) was expressed in vitro E.coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 43-685aa |
Tag : | Non |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 73.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFTSGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR |
Gene Name | GALC galactosylceramidase [ Homo sapiens ] |
Official Symbol | GALC |
Synonyms | GALC; galactosylceramidase; galactosylceramidase (Krabbe disease); galactocerebrosidase; Krabbe disease; GALCERase; galactosylceraminidase; galactocerebroside beta-galactosidase; galactosylceramide beta-galactosidase; |
Gene ID | 2581 |
mRNA Refseq | NM_000153 |
Protein Refseq | NP_000144 |
MIM | 606890 |
UniProt ID | P54803 |
◆ Recombinant Proteins | ||
GALC-1803R | Recombinant Rhesus monkey GALC Protein, His-tagged | +Inquiry |
Galc-9308MFL | Recombinant Full Length Mouse Galc, Flag-tagged | +Inquiry |
Galc-200M | Recombinant Mouse Galc, Myc-His-tagged | +Inquiry |
GALC-605H | Active Recombinant Human GALC, His-tagged | +Inquiry |
GALC-528H | Recombinant Human GALC Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALC-679HCL | Recombinant Human GALC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALC Products
Required fields are marked with *
My Review for All GALC Products
Required fields are marked with *
0
Inquiry Basket