Recombinant Human GAGE7 protein(1-117aa), His-tagged

• Cat.No.: GAGE7-2924H
• Product Overview: Recombinant Human GAGE7 protein(O76087)(1-117aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-117aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Gene Information

• Gene Name: GAGE7 G antigen 7 [ Homo sapiens ]
• Official Symbol: GAGE7
• Synonyms: G antigen 7; 4104; G antigen 12G;cancer/testis antigen 4.7;cancer/testis antigen family 4, member 7; AL4; CT4.7; GAGE-7
• Gene ID: 2579
• mRNA Refseq: NM_021123.2
• Protein Refseq: NP_066946.1
• MIM: 300601
• UniProt ID: O76087