Recombinant Full Length Human GAGE7 Protein, GST-tagged

Cat.No. : GAGE7-5215HF
Product Overview : Human GAGE7 full-length ORF (ABM85267.1, 1 a.a. - 117 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 117 amino acids
Description : GAGE7 (G Antigen 7) is a Protein Coding gene.
Molecular Mass : 39.27 kDa
AA Sequence : MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAGE7 G antigen 7 [ Homo sapiens ]
Official Symbol GAGE7
Synonyms G antigen 7; 4104; G antigen 12G;cancer/testis antigen 4.7;cancer/testis antigen family 4, member 7; AL4; CT4.7; GAGE-7
Gene ID 2579
mRNA Refseq NM_021123
Protein Refseq NP_066946
MIM 300601
UniProt ID O76087

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GAGE7 Products

Required fields are marked with *

My Review for All GAGE7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon