Recombinant Full Length Human GAGE7 Protein, GST-tagged

• Cat.No.: GAGE7-5215HF
• Product Overview: Human GAGE7 full-length ORF (ABM85267.1, 1 a.a. - 117 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: GAGE7 (G Antigen 7) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.27 kDa
• Protein length: 117 amino acids
• AA Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAGE7 G antigen 7 [ Homo sapiens ]
• Official Symbol: GAGE7
• Synonyms: G antigen 7; 4104; G antigen 12G;cancer/testis antigen 4.7;cancer/testis antigen family 4, member 7; AL4; CT4.7; GAGE-7
• Gene ID: 2579
• mRNA Refseq: NM_021123
• Protein Refseq: NP_066946
• MIM: 300601
• UniProt ID: O76087