Recombinant Human GAGE1 Protein, GST-tagged
Cat.No. : | GAGE1-4663H |
Product Overview : | Human GAGE1 full-length ORF ( NP_001459.2, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq |
Molecular Mass : | 42 kDa |
AA Sequence : | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAGE1 G antigen 1 [ Homo sapiens ] |
Official Symbol | GAGE1 |
Synonyms | CT4.1; GAGE-1; GAGE1; G antigen 1; G Antigen 1; Cancer/Testis Antigen Family 4, Member 1; Cancer/Testis Antigen 4.1; CT4.1; MZ2-F Antigen; Antigen MZ2-F |
Gene ID | 2543 |
mRNA Refseq | NM_001468 |
Protein Refseq | NP_001459 |
MIM | 300594 |
UniProt ID | Q13065 |
◆ Recombinant Proteins | ||
GAGE1-26549TH | Recombinant Human GAGE1 | +Inquiry |
GAGE1-5211HF | Recombinant Full Length Human GAGE1 Protein, GST-tagged | +Inquiry |
GAGE1-189HF | Recombinant Full Length Human GAGE1 Protein | +Inquiry |
GAGE1-4663H | Recombinant Human GAGE1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAGE1-6051HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
GAGE1-6050HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAGE1 Products
Required fields are marked with *
My Review for All GAGE1 Products
Required fields are marked with *
0
Inquiry Basket