Recombinant Human GAGE1 Protein, GST-tagged

• Cat.No.: GAGE1-4663H
• Product Overview: Human GAGE1 full-length ORF ( NP_001459.2, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42 kDa
• AA Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAGE1 G antigen 1 [ Homo sapiens ]
• Official Symbol: GAGE1
• Synonyms: CT4.1; GAGE-1; GAGE1; G antigen 1; G Antigen 1; Cancer/Testis Antigen Family 4, Member 1; Cancer/Testis Antigen 4.1; CT4.1; MZ2-F Antigen; Antigen MZ2-F
• Gene ID: 2543
• mRNA Refseq: NM_001468
• Protein Refseq: NP_001459
• MIM: 300594
• UniProt ID: Q13065