Recombinant Human GABRB3 Protein, GST-tagged
Cat.No. : | GABRB3-4647H |
Product Overview : | Human GABRB3 partial ORF ( AAH10641, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding isoforms with distinct signal peptides have been described. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ] |
Official Symbol | GABRB3 |
Synonyms | GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; GABA(A) receptor; beta 3; GABA(A) receptor, beta 3; GABAA receptor beta-3 subunit; GABA(A) receptor beta-3 subunit; GABA-alpha receptor beta-2 subunit; ECA5; MGC9051; |
Gene ID | 2562 |
mRNA Refseq | NM_000814 |
Protein Refseq | NP_000805 |
MIM | 137192 |
UniProt ID | P28472 |
◆ Recombinant Proteins | ||
DHRS13B-951Z | Recombinant Zebrafish DHRS13B | +Inquiry |
RNF113A-5826H | Recombinant Human RNF113A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL11809EF | Recombinant Full Length Escherichia Coli O9:H4 Potassium-Transporting Atpase C Chain(Kdpc) Protein, His-Tagged | +Inquiry |
Fdxr-2983M | Recombinant Mouse Fdxr Protein, Myc/DDK-tagged | +Inquiry |
RACGAP1-3588R | Recombinant Rhesus Macaque RACGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
HP-199M | Native Monkey Haptoglobin | +Inquiry |
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
IgG-352G | Native HAMSTER IgG | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-119M | Mouse Spleen Tissue Lysate (7 Days Old) | +Inquiry |
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
CD3G-7675HCL | Recombinant Human CD3G 293 Cell Lysate | +Inquiry |
PKIB-3156HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
SAMD4B-574HCL | Recombinant Human SAMD4B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABRB3 Products
Required fields are marked with *
My Review for All GABRB3 Products
Required fields are marked with *
0
Inquiry Basket