Recombinant Human GABRB3 Protein, GST-tagged

• Cat.No.: GABRB3-4647H
• Product Overview: Human GABRB3 partial ORF ( AAH10641, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding isoforms with distinct signal peptides have been described. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ]
• Official Symbol: GABRB3
• Synonyms: GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3; GABA(A) receptor; beta 3; GABA(A) receptor, beta 3; GABAA receptor beta-3 subunit; GABA(A) receptor beta-3 subunit; GABA-alpha receptor beta-2 subunit; ECA5; MGC9051
• Gene ID: 2562
• mRNA Refseq: NM_000814
• Protein Refseq: NP_000805
• MIM: 137192
• UniProt ID: P28472