Recombinant Human GABRB2 protein, His-tagged
Cat.No. : | GABRB2-4264H |
Product Overview : | Recombinant Human GABRB2 protein(P47870)(26-244aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-244aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GABRB2 gamma-aminobutyric acid (GABA) A receptor, beta 2 [ Homo sapiens ] |
Official Symbol | GABRB2 |
Synonyms | GABRB2; gamma-aminobutyric acid (GABA) A receptor, beta 2; gamma-aminobutyric acid receptor subunit beta-2; GABA(A) receptor; beta 2; GABA(A) receptor, beta 2; GABA(A) receptor subunit beta-2; gamma-aminobutyric acid A receptor beta 2; MGC119386; MGC119388; MGC119389; |
Gene ID | 2561 |
mRNA Refseq | NM_000813 |
Protein Refseq | NP_000804 |
MIM | 600232 |
UniProt ID | P47870 |
◆ Recombinant Proteins | ||
GABRB2-1615R | Recombinant Rhesus Macaque GABRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gabrb2-1549R | Recombinant Rat Gabrb2 Protein, His-tagged | +Inquiry |
GABRB2-4264H | Recombinant Human GABRB2 protein, His-tagged | +Inquiry |
GABRB2-2105R | Recombinant Rat GABRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABRB2-5069C | Recombinant Chicken GABRB2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABRB2-6061HCL | Recombinant Human GABRB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABRB2 Products
Required fields are marked with *
My Review for All GABRB2 Products
Required fields are marked with *
0
Inquiry Basket