Recombinant Human GABRA2 Protein, GST-tagged

Cat.No. : GABRA2-390H
Product Overview : Recombinant Human GABRA2 Protein(348-412 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 348-412 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol GABRA2
Synonyms GABRA2; gamma-aminobutyric acid (GABA) A receptor, alpha 2; gamma-aminobutyric acid receptor subunit alpha-2; GABA(A) receptor; alpha 2; GABA(A) receptor, alpha 2; GABA(A) receptor subunit alpha-2; FLJ97076;
Gene ID 2555
mRNA Refseq NM_000807
Protein Refseq NP_000798
MIM 137140
UniProt ID P47869

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GABRA2 Products

Required fields are marked with *

My Review for All GABRA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon