Recombinant Human GABRA2 Protein, GST-tagged

• Cat.No.: GABRA2-390H
• Product Overview: Recombinant Human GABRA2 Protein(348-412 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 348-412 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: GABRA2
• Synonyms: GABRA2; gamma-aminobutyric acid (GABA) A receptor, alpha 2; gamma-aminobutyric acid receptor subunit alpha-2; GABA(A) receptor; alpha 2; GABA(A) receptor, alpha 2; GABA(A) receptor subunit alpha-2; FLJ97076
• Gene ID: 2555
• mRNA Refseq: NM_000807
• Protein Refseq: NP_000798
• MIM: 137140
• UniProt ID: P47869