Recombinant Human GABARAPL2, His-tagged

• Cat.No.: GABARAPL2-27460TH
• Product Overview: Recombinant full length Human GABARAPL2 with an N terminal His tag; 137 amino acids with a predicted MWt 15.8 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 117 amino acids
• Description: GABARAPL2, also known as ATG8, is involved in intra Golgi traffic and modulates intra Golgi transport through coupling between NSF activity and SNAREs activation.
• Conjugation: HIS
• Molecular Weight: 15.800kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Gene Information

• Gene Name: GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ]
• Official Symbol: GABARAPL2
• Synonyms: GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2
• Gene ID: 11345
• mRNA Refseq: NM_007285
• Protein Refseq: NP_009216
• MIM: 607452
• Uniprot ID: P60520
• Chromosome Location: 16q22.1
• Pathway: GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem
• Function: ATPase binding; GABA receptor binding; GABA receptor binding; SNARE binding; beta-tubulin binding