Recombinant Full Length Human GABARAPL2 Protein, GST-tagged

• Cat.No.: GABARAPL2-5149HF
• Product Overview: Human GABARAPL2 full-length ORF (AAH05985.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GABARAPL2 (GABA Type A Receptor Associated Protein Like 2) is a Protein Coding gene. Diseases associated with GABARAPL2 include Amyotrophic Lateral Sclerosis Type 14 and Neuronal Ceroid Lipofuscinosis. Among its related pathways are Mitophagy - animal and Vesicle-mediated transport. GO annotations related to this gene include microtubule binding and SNARE binding. An important paralog of this gene is GABARAPL1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.27 kDa
• Protein length: 117 amino acids
• AA Sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ]
• Official Symbol: GABARAPL2
• Synonyms: GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2; ganglioside expression factor 2; MAP1 light chain 3 related protein; MAP1 light chain 3-related protein; general protein transport factor p16; golgi-associated ATPase enhancer of 16 kDa; GEF-2; GATE-16
• Gene ID: 11345
• mRNA Refseq: NM_007285
• Protein Refseq: NP_009216
• MIM: 607452
• UniProt ID: P60520