Recombinant Human BMI1 Protein(1-117aa), GST-tagged

• Cat.No.: GABARAPL2-482H
• Product Overview: Recombinant Human BMI1 Protein(1-117aa)(P60520), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Protein length: 1-117aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.7kDa
• AA Sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: GABARAPL2 GABA(A) receptor-associated protein-like 2 [ Homo sapiens ]
• Official Symbol: GABARAPL2
• Synonyms: GABARAPL2; GABA(A) receptor-associated protein-like 2; gamma-aminobutyric acid receptor-associated protein-like 2; ATG8; ATG8C; GATE 16; GATE16; GEF2; ganglioside expression factor 2; MAP1 light chain 3 related protein; MAP1 light chain 3-related protein; general protein transport factor p16; golgi-associated ATPase enhancer of 16 kDa; GEF-2; GATE-16
• Gene ID: 11345
• mRNA Refseq: NM_007285
• Protein Refseq: NP_009216
• MIM: 607452
• UniProt ID: P60520