Recombinant Human GABA(A) receptor-associated protein, His-tagged

• Cat.No.: GABARAP-4365H
• Product Overview: GABARAP Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 137 amino acids (1-117 a.a.) and having a molecular mass of 16 kDa. GABARAP is fused to a 20 amino acid His-Tag at N-Terminus and purified by proprietary chromatographic techniques.

Specification

• Cat. No.: GABARAP-4365H
• Description: GABARAP is a ligand-gated chloride channel that mediates inhibitory neurotransmission. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
• Source: Human
• Host: Escherichia Coli
• Form: GABARAP solution containing 20mM Tris pH-8, 0.2M NaCl and 20% glycerol.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Physical Appearance: Sterile filtered colorless solution.
• Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSE GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVG QFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH EEDFFLYIAYSDESVYGL.
• Storage: GABARAP Human Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
• Pathways: Regulation of autophagy
• Functions: GABA receptor binding; beta-tubulin binding; microtubule binding; protein binding
• Protein length: 1-117 a.a.

Gene Information

• Gene Name: GABARAP GABA(A) receptor-associated protein [ Homo sapiens ]
• Official Symbol: GABARAP
• Synonyms: GABARAP; GABA(A) receptor-associated protein; MM46; FLJ25768; MGC120154; MGC120155; Gamma-aminobutyric acid receptor-associated protein; FLC3B
• Gene ID: 11337
• mRNA Refseq: NM_007278
• Protein Refseq: NP_009209
• MIM: 605125
• UniProt ID: O95166
• Chromosome Location: 17