Recombinant Human GABA(A) receptor-associated protein, His-tagged
Cat.No. : | GABARAP-4365H |
Product Overview : | GABARAP Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 137 amino acids (1-117 a.a.) and having a molecular mass of 16 kDa. GABARAP is fused to a 20 amino acid His-Tag at N-Terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Protein Length : | 1-117 a.a. |
Description : | GABARAP is a ligand-gated chloride channel that mediates inhibitory neurotransmission. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. |
Form : | GABARAP solution containing 20mM Tris pH-8, 0.2M NaCl and 20% glycerol. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Physical Appearance : | Sterile filtered colorless solution. |
Amino Acid Sequence : | MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSE GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVG QFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH EEDFFLYIAYSDESVYGL. |
Storage : | GABARAP Human Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
Pathways : | Regulation of autophagy |
Functions : | GABA receptor binding; beta-tubulin binding; microtubule binding; protein binding |
Gene Name | GABARAP GABA(A) receptor-associated protein [ Homo sapiens ] |
Official Symbol | GABARAP |
Synonyms | GABARAP; GABA(A) receptor-associated protein; MM46; FLJ25768; MGC120154; MGC120155; Gamma-aminobutyric acid receptor-associated protein; FLC3B |
Gene ID | 11337 |
mRNA Refseq | NM_007278 |
Protein Refseq | NP_009209 |
MIM | 605125 |
UniProt ID | O95166 |
Chromosome Location | 17 |
◆ Recombinant Proteins | ||
GABARAP-13085H | Recombinant Human GABARAP, GST-tagged | +Inquiry |
GABARAP-703H | Recombinant Human GABARAP Protein, His&MBP-tagged | +Inquiry |
GABARAP-580H | Active Recombinant Human GABARAP Protein, His-tagged Protein, Fluorescein | +Inquiry |
GABARAP-1607R | Recombinant Rhesus Macaque GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
GABARAP-3421M | Recombinant Mouse GABARAP Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABARAP Products
Required fields are marked with *
My Review for All GABARAP Products
Required fields are marked with *
0
Inquiry Basket