Recombinant Human FXYD4 Protein, Flag-tagged

• Cat.No.: FXYD4-1376H
• Product Overview: Recombinant Human FXYD4 Protein is produced by HEK293T expression system. This protein is fused with a Flag tag.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Description: This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.
• Form: PBS buffer
• Molecular Mass: 9 kDa
• AA Sequence: MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: FXYD4 FXYD domain containing ion transport regulator 4 [ Homo sapiens ]
• Official Symbol: FXYD4
• Synonyms: CHIF
• Gene ID: 53828
• mRNA Refseq: NM_173160.2
• Protein Refseq: NP_775183.1
• UniProt ID: P59646