Recombinant Human FXYD3 Protein, GST-tagged

• Cat.No.: FXYD3-4580H
• Product Overview: Human FXYD3 full-length ORF ( AAH05238, 21 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.11 kDa
• AA Sequence: NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ]
• Official Symbol: FXYD3
• Synonyms: FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3, PLML; FXYD domain-containing ion transport regulator 3; MAT 8; phospholemman-like protein; mammary tumor 8 kDa protein; chloride conductance inducer protein Mat-8; MAT8; PLML; MGC111076
• Gene ID: 5349
• mRNA Refseq: NM_001136007
• Protein Refseq: NP_001129479
• MIM: 604996
• UniProt ID: Q14802