Recombinant Full Length Human FXYD3 Protein
Cat.No. : | FXYD3-172HF |
Product Overview : | Recombinant full length Human FXDY3 with N terminal proprietary tag; Predicted MWt 33.48 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 67 amino acids |
Description : | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | Liquid |
Molecular Mass : | 33.480kDa inclusive of tags |
AA Sequence : | NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ] |
Official Symbol | FXYD3 |
Synonyms | FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3 , PLML; FXYD domain-containing ion transport regulator 3; MAT 8 |
Gene ID | 5349 |
mRNA Refseq | NM_001136007 |
Protein Refseq | NP_001129479 |
MIM | 604996 |
UniProt ID | Q14802 |
◆ Recombinant Proteins | ||
RFL32568SF | Recombinant Full Length Pig Fxyd Domain-Containing Ion Transport Regulator 3(Fxyd3) Protein, His-Tagged | +Inquiry |
FXYD3-26269TH | Recombinant Human FXYD3 | +Inquiry |
FXYD3-1353H | Recombinant Human FXYD3, MYC&DDK-tagged | +Inquiry |
FXYD3-2078R | Recombinant Rat FXYD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fxyd3-3114M | Recombinant Mouse Fxyd3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD3-6100HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD3 Products
Required fields are marked with *
My Review for All FXYD3 Products
Required fields are marked with *
0
Inquiry Basket