Description :	This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	49.5 kDa
AA Sequence :	MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	FXN frataxin [ Homo sapiens ]
Official Symbol	FXN
Synonyms	FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199;
Gene ID	2395
mRNA Refseq	NM_000144
Protein Refseq	NP_000135
MIM	606829
UniProt ID	Q16595