Recombinant Human FUT3 Protein (35-361), N-His tagged

• Cat.No.: FUT3-129H
• Product Overview: Recombinant Human FUT3 Protein (35-361) with N-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 35-361
• Description: The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Differences in the expression of this gene are associated with host susceptibility to viral infection.
• Molecular Mass: 39.72 kDa
• AA Sequence: MGHHHHHHSGSEFRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT
• Purity: ≥85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.3 mg/mL
• Storage Buffer: PBS buffer, pH 7.4

Gene Information

• Gene Name: FUT3 fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group) [ Homo sapiens (human) ]
• Official Symbol: FUT3
• Synonyms: FUT3; fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group); fucosyltransferase 3 (galactoside 3(4) L fucosyltransferase, Lewis blood group included), LE; galactoside 3(4)-L-fucosyltransferase; CD174; Lewis FT; fucosyltransferase III; alpha-(1,3/1,4)-fucosyltransferase; blood group Lewis alpha-4-fucosyltransferase; LE; Les; FT3B; FucT-III; MGC131739
• Gene ID: 2525
• mRNA Refseq: NM_000149
• Protein Refseq: NP_000140
• MIM: 111100
• UniProt ID: P21217