Recombinant Human FUS protein, His&Myc-tagged

• Cat.No.: FUS-3533H
• Product Overview: Recombinant Human FUS protein(P35637)(1-526aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 1-526aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60.9 kDa
• AASequence: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: FUS fused in sarcoma [ Homo sapiens ]
• Official Symbol: FUS
• Synonyms: FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; TLS; translocated in liposarcoma; oncogene FUS; oncogene TLS; fus-like protein; 75 kDa DNA-pairing protein; fusion gene in myxoid liposarcoma; translocated in liposarcoma protein; ALS6; POMP75; HNRNPP2
• Gene ID: 2521
• mRNA Refseq: NM_001170634
• Protein Refseq: NP_001164105
• MIM: 137070
• UniProt ID: P35637