Recombinant Human FTO, GST-tagged

• Cat.No.: FTO-118H
• Product Overview: Human FTO full-length ORF ( AAH01284.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes.
• Molecular Mass: 41.8 kDa
• AA Sequence: MGHPRAIQPSVFFSPYDVHFLLYPIRCPYLKIGRFHIKLKGLHFLFSFLFFFFETQSHSVTRLECSGTISAHCNL CLPGSSNSPASASQVAGTTGTCHHAQLIFVFLAEMGFHHIGQDGLDLNLVIHPPRSPKALGLQA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FTO fat mass and obesity associated [ Homo sapiens (human) ]
• Official Symbol: FTO
• Synonyms: FTO; ALKBH9; fat mass and obesity associated; alpha-ketoglutarate-dependent dioxygenase FTO; protein fto; AlkB homolog 9; fat mass and obesity-associated protein
• Gene ID: 79068
• mRNA Refseq: NM_001080432
• Protein Refseq: NP_001073901
• MIM: 610966
• UniProt ID: Q9C0B1
• Chromosome Location: 16q12.2
• Function: DNA-N1-methyladenine dioxygenase activity; ferrous iron binding; oxidative DNA demethylase activity