Recombinant Human FSHB Protein, GST-tagged
Cat.No. : | FSHB-4519H |
Product Overview : | Human FSHB partial ORF ( NP_000501.1, 19 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | April 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq |
Molecular Mass : | 37.95 kDa |
AA Sequence : | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FSHB follicle stimulating hormone, beta polypeptide [ Homo sapiens ] |
Official Symbol | FSHB |
Synonyms | FSHB; follicle stimulating hormone, beta polypeptide; follitropin subunit beta; follicle stimulating hormone beta subunit; follitropin; beta chain; FSH-B; FSH-beta; follitropin beta chain; follitropin, beta chain; follicle-stimulating hormone beta subunit; |
Gene ID | 2488 |
mRNA Refseq | NM_000510 |
Protein Refseq | NP_000501 |
MIM | 136530 |
UniProt ID | P01225 |
◆ Recombinant Proteins | ||
FSHB-1527H | Recombinant Human FSHB Protein, His-tagged | +Inquiry |
fshb-20D | Recombinant Danio rerio fshb & cga, Strep-tagged | +Inquiry |
FSHB-11659Z | Recombinant Zebrafish FSHB | +Inquiry |
Fshb-8232R | Recombinant Rat Fshb protein, His & T7-tagged | +Inquiry |
FSHB-2432H | Recombinant Human FSHB Protein (Asn19-Glu129), C-His tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSHB-6131HCL | Recombinant Human FSHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSHB Products
Required fields are marked with *
My Review for All FSHB Products
Required fields are marked with *
0
Inquiry Basket