Recombinant Danio rerio fshb & cga, Strep-tagged

• Cat.No.: fshb-20D
• Product Overview: Recombinant protein is encoded by a fusion of the mature follitropin subunit beta (residues 17 - 130) and glycoprotein hormones alphachain (residues 24 - 117) linked by a (gggs)4 peptide. It contains a N-terminal Strep-tag. The protein was over-expressed in HEK293EBNA1 cells and purified to homogeneity.

Specification

• Species: Zebrafish
• Source: HEK293
• Tag: Strep II
• Protein Length: 17-130 a.a.
• Description: The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit that confers biological specificity.
• Form: PBS without preservative.
• Molecular Mass: The calculated molecular weight of recombinant Danio rerio FSH is 27.9 kDa.
• AA Sequence: gswshpqfekgswshpqfekgswshpqfekgsaesecrcscrltnisitveseecgscvtidttacaglcwtmdr vypssmaqhtqkvcnfknlmyksyefkgcpagvdsvfvypvalscecnqvnsdttdwgaispqttscsihgggsg ggsgggsgggysrndvsnygceecklkmnerfskpgapvyqcvgccfsrayptplrskktmlvpknitseatccv akeskmvatniplynhtdchcstcyyhks
• Storage: - 80 °C (stable for at least 1 year). After thawing it should be stored in appropriate small aliquots at - 20 °C or - 80 °C (stable for at least 2 months).