Recombinant Human FOXR1 Protein, GST-tagged

• Cat.No.: FOXR1-4479H
• Product Overview: Human FOXR1 partial ORF ( NP_859072.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the forkhead box (FOX) family of transcription factors. FOX family members are monomeric, helix-turn-helix proteins with a core DNA-binding domain of approximately 110 aa. Many FOX transcription factors play roles in determining cell fates during early development. This forkhead box protein lacks the C-terminal basic region found in many other FOX family members. It is located within the 11q23.3 region which is commonly deleted in neuroblastomas. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: MGNELFLAFTTSHLPLAEQKLARYKLRIVKPPKLPLEKKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXR1 forkhead box R1 [ Homo sapiens ]
• Official Symbol: FOXR1
• Synonyms: FOXR1; forkhead box R1; forkhead box protein R1; DLNB13; FOXN5; forkhead box protein N5; forkhead box R1 variant 1; MGC149486
• Gene ID: 283150
• mRNA Refseq: NM_181721
• Protein Refseq: NP_859072
• MIM: 615755
• UniProt ID: Q6PIV2