Recombinant Human FOXP3 Protein, His-tagged

Cat.No. : FOXP3-1216H
Product Overview : Recombinant Human FOXP3 Protein (1-260aa) was expressed in E. coli with N-terminal His-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-260 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 31.7 kDa
AA Sequence : MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ
LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV
FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE
PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name FOXP3 forkhead box P3 [ Homo sapiens ]
Official Symbol FOXP3
Synonyms FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963
Gene ID 50943
mRNA Refseq NM_001114377
Protein Refseq NP_001107849
MIM 300292
UniProt ID Q9BZS1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FOXP3 Products

Required fields are marked with *

My Review for All FOXP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon