Recombinant Human FOXP1 protein, GST-tagged

• Cat.No.: FOXP1-12H
• Product Overview: Recombinant Human FOXP1(1 a.a. - 114 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 38.28 kDa
• AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-114 a.a.

Gene Information

• Gene Name: FOXP1 forkhead box P1 [ Homo sapiens ]
• Official Symbol: FOXP1
• Synonyms: FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1; glutamine-rich factor 1; fork head-related protein like B; FLJ23741; MGC12942; MGC88572; MGC99551
• Gene ID: 27086
• mRNA Refseq: NM_001012505
• Protein Refseq: NP_001012523
• MIM: 605515
• UniProt ID: Q9H334
• Chromosome Location: 3p14.1
• Function: DNA binding, bending; chromatin binding; double-stranded DNA binding; metal ion binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; zinc ion binding