Recombinant Human FOXO1 Protein, GST-tagged

• Cat.No.: FOXO1-4469H
• Product Overview: Human FOXO1 partial ORF (NP_002006.2, 452 a.a. - 555 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 452-555 a.a.
• Description: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq
• Molecular Mass: 37.07 kDa
• AA Sequence: MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXO1 forkhead box O1 [ Homo sapiens ]
• Official Symbol: FOXO1
• Synonyms: FOXO1; forkhead box O1; FKHR, forkhead homolog in rhabdomyosarcoma, FOXO1A; forkhead box protein O1; FKH1; forkhead box protein O1A; forkhead, Drosophila, homolog of, in rhabdomyosarcoma; FKHR; FOXO1A
• Gene ID: 2308
• mRNA Refseq: NM_002015
• Protein Refseq: NP_002006
• MIM: 136533
• UniProt ID: Q12778