Recombinant Human FOXM1 Protein, His-SUMO/MYC-tagged

• Cat.No.: FOXM1-1215H
• Product Overview: Recombinant Human FOXM1 Protein (235-327aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC-tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• ProteinLength: 235-327 a.a.
• Description: The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 31.2 kDa
• AA Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGK
  VSFWTIHPSANRYLTLDQVFKPL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: FOXM1 forkhead box M1 [ Homo sapiens (human) ]
• Official Symbol: FOXM1
• Synonyms: MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1B; HFH-11; TRIDENT; MPHOSPH2; FOXM1
• Gene ID: 2305
• mRNA Refseq: NM_202002.2
• Protein Refseq: NP_973731.1
• MIM: 602341
• UniProt ID: Q08050