Recombinant Human FOXI1 Protein, GST-tagged

• Cat.No.: FOXI1-4454H
• Product Overview: Human FOXI1 full-length ORF ( NP_658982.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 57.20 kDa
• AA Sequence: MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXI1 forkhead box I1 [ Homo sapiens ]
• Official Symbol: FOXI1
• Synonyms: FOXI1; forkhead box I1; FKHL10; forkhead box protein I1; FREAC6; forkhead-like 10; HNF-3/fork-head homolog 3; HNF-3/fork-head homolog-3; forkhead-related activator 6; forkhead-related protein FKHL10; forkhead-related transcription factor 6; hepatocyte nuclear factor 3 forkhead homolog 3; HFH3; FKH10; HFH-3; FREAC-6; MGC34197
• Gene ID: 2299
• mRNA Refseq: NM_012188
• Protein Refseq: NP_036320
• MIM: 601093
• UniProt ID: Q12951