Recombinant Human FOXF2 Protein, GST-tagged

• Cat.No.: FOXF2-4450H
• Product Overview: Human FOXF2 partial ORF (NP_001443.1, 346 a.a. - 443 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 346-443 a.a.
• Description: FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq
• Molecular Mass: 36.52 kDa
• AA Sequence: SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXF2 forkhead box F2 [ Homo sapiens ]
• Official Symbol: FOXF2
• Synonyms: FOXF2; forkhead box F2; FKHL6; forkhead box protein F2; FREAC2; FREAC-2; forkhead-like 6; forkhead-related activator 2; forkhead-related protein FKHL6; forkhead-related transcription factor 2
• Gene ID: 2295
• mRNA Refseq: NM_001452
• Protein Refseq: NP_001443
• MIM: 603250
• UniProt ID: Q12947