Recombinant Human FOXD2 Protein, GST-tagged

• Cat.No.: FOXD2-4441H
• Product Overview: Human FOXD2 partial ORF ( NP_004465.2, 411 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.98 kDa
• AA Sequence: SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXD2 forkhead box D2 [ Homo sapiens ]
• Official Symbol: FOXD2
• Synonyms: FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9; forkhead-like 17; forkhead-related activator 9; forkhead-related protein FKHL17; forkhead, drosophila, homolog-like 17; forkhead-related transcription factor 9; FREAC-9
• Gene ID: 2306
• mRNA Refseq: NM_004474
• Protein Refseq: NP_004465
• MIM: 602211
• UniProt ID: O60548