Recombinant Human FOXD2

Cat.No. : FOXD2-28109TH
Product Overview : Recombinant fragment of Human FOXD2 (amino acids 411-494) with a N terminal proprietary tag; Predicted MWt 34.87 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 84 amino acids
Description : This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined.
Molecular Weight : 34.870kDa inclusive of tags
Tissue specificity : Kidney specific.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
Sequence Similarities : Contains 1 fork-head DNA-binding domain.
Gene Name FOXD2 forkhead box D2 [ Homo sapiens ]
Official Symbol FOXD2
Synonyms FOXD2; forkhead box D2; FKHL17; forkhead box protein D2; FREAC9;
Gene ID 2306
mRNA Refseq NM_004474
Protein Refseq NP_004465
MIM 602211
Uniprot ID O60548
Chromosome Location 1p34-p32
Function DNA bending activity; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FOXD2 Products

Required fields are marked with *

My Review for All FOXD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon