Recombinant Human FOXC1 Protein, GST-tagged

• Cat.No.: FOXC1-4437H
• Product Overview: Human FOXC1 partial ORF ( NP_001444.1, 74 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXC1 forkhead box C1 [ Homo sapiens ]
• Official Symbol: FOXC1
• Synonyms: FOXC1; forkhead box C1; FKHL7, IRID1; forkhead box protein C1; ARA; FREAC3; IGDA; IHG1; myeloid factor-delta; forkhead-related activator 3; forkhead-related protein FKHL7; forkhead, drosophila, homolog-like 7; forkhead-related transcription factor 3; forkhead/winged helix-like transcription factor 7; FKHL7; IRID1; RIEG3; FREAC-3
• Gene ID: 2296
• mRNA Refseq: NM_001453
• Protein Refseq: NP_001444
• MIM: 601090
• UniProt ID: Q12948