Recombinant Human FOXA3 protein, Arginine-tagged

• Cat.No.: FOXA3-133H
• Product Overview: Recombinant human FOXA3 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: GEFLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAP LGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIM DLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGG SGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPY NFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNASLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for study of Human liver cell differentiation in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: FOXA3 forkhead box A3 [ Homo sapiens ]
• Official Symbol: FOXA3
• Synonyms: FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma , HNF3G; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; FKHH3; HNF3G; TCF3G; MGC10179
• Gene ID: 3171
• mRNA Refseq: NM_004497
• Protein Refseq: NP_004488
• MIM: 602295
• UniProt ID: P55318
• Chromosome Location: 19q13.2-q13.4
• Pathway: Developmental Biology, organism-specific biosystem; FOXA transcription factor networks, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem
• Function: DNA binding, bending; double-stranded DNA binding; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding